Lineage for d1dtwb1 (1dtw B:17-204)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22854Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 22855Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 22922Family c.36.1.3: Branched-chain alpha-keto acid dehydrogenase [52531] (2 proteins)
  6. 22927Protein Branched-chain alpha-keto acid dehydrogenase [52532] (1 species)
  7. 22928Species Human (Homo sapiens) [TaxId:9606] [52533] (1 PDB entry)
  8. 22930Domain d1dtwb1: 1dtw B:17-204 [31828]
    Other proteins in same PDB: d1dtwb2

Details for d1dtwb1

PDB Entry: 1dtw (more details), 2.7 Å

PDB Description: human branched-chain alpha-keto acid dehydrogenase

SCOP Domain Sequences for d1dtwb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dtwb1 c.36.1.3 (B:17-204) Branched-chain alpha-keto acid dehydrogenase {Human (Homo sapiens)}
qtqkmnlfqsvtsaldnslakdptavifgedvafggvfrctvglrdkygkdrvfntplce
qgivgfgigiavtgataiaeiqfadyifpafdqivneaakyryrsgdlfncgsltirspw
gcvghgalyhsqspeaffahcpgikvviprspfqakglllsciedknpciffepkilyra
aaeevpie

SCOP Domain Coordinates for d1dtwb1:

Click to download the PDB-style file with coordinates for d1dtwb1.
(The format of our PDB-style files is described here.)

Timeline for d1dtwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dtwb2
View in 3D
Domains from other chains:
(mouse over for more information)
d1dtwa1