Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
Superfamily c.56.3: Peptidyl-tRNA hydrolase-like [53178] (2 families) |
Family c.56.3.0: automated matches [193325] (1 protein) not a true family |
Protein automated matches [193326] (11 species) not a true protein |
Species Vibrio cholerae [TaxId:243277] [311867] (9 PDB entries) |
Domain d4z86b1: 4z86 B:3-197 [318276] Other proteins in same PDB: d4z86a2, d4z86b2 automated match to d4y2zb_ mutant |
PDB Entry: 4z86 (more details), 1.63 Å
SCOPe Domain Sequences for d4z86b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4z86b1 c.56.3.0 (B:3-197) automated matches {Vibrio cholerae [TaxId: 243277]} sqpikllvglanpgpeyaktrhnagawvveelarihnvtlknepkffgltgrllinsqel rvlipttfmnlsgkaiaalanfyqikpeeimvahdeldlppgvakfkqggghgghdglkd tisklgnnkefyrlrlgighpghkdkvagyvlgkapakeqexldaavdesvrcleilmkd gltkaqnrlhtfkae
Timeline for d4z86b1: