Lineage for d5icfa2 (5icf A:105-350)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2894468Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2894469Protein automated matches [190689] (87 species)
    not a true protein
  7. 2895055Species Thalictrum flavum [TaxId:150095] [318181] (8 PDB entries)
  8. 2895061Domain d5icfa2: 5icf A:105-350 [318270]
    Other proteins in same PDB: d5icfa1, d5icfa3
    automated match to d1fp2a2
    complexed with dms, edo, k, na, sah, sau

Details for d5icfa2

PDB Entry: 5icf (more details), 1.8 Å

PDB Description: crystal structure of (s)-norcoclaurine 6-o-methyltransferase with s- adenosyl-l-homocysteine and sanguinarine
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icfa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icfa2 c.66.1.0 (A:105-350) automated matches {Thalictrum flavum [TaxId: 150095]}
kcmlgailtitdkdfmapwhylkegilndgststafekalgtniwdymaehpeknqlfne
gmandtrlimsalvkecssmfdgittivdvgggtgtavrniakafphikctvydlphvia
dspgyteinsiqgdmfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviii
diildvksehpytkmrltldldmmlntggkerteeewkklihdagykgykithisavqsv
ieaypy

SCOPe Domain Coordinates for d5icfa2:

Click to download the PDB-style file with coordinates for d5icfa2.
(The format of our PDB-style files is described here.)

Timeline for d5icfa2: