Lineage for d5icfa1 (5icf A:3-104)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981563Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982668Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1984178Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1984179Protein automated matches [190154] (68 species)
    not a true protein
  7. 1984644Species Thalictrum flavum [TaxId:150095] [318179] (4 PDB entries)
  8. 1984646Domain d5icfa1: 5icf A:3-104 [318269]
    Other proteins in same PDB: d5icfa2, d5icfa3
    automated match to d1fp2a1
    complexed with dms, edo, k, na, sah, sau

Details for d5icfa1

PDB Entry: 5icf (more details), 1.8 Å

PDB Description: crystal structure of (s)-norcoclaurine 6-o-methyltransferase with s- adenosyl-l-homocysteine and sanguinarine
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icfa1 a.4.5.0 (A:3-104) automated matches {Thalictrum flavum [TaxId: 150095]}
minkenlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvn
qdalyrvlrylvhmklftkssidgelryglappakflvkgwd

SCOPe Domain Coordinates for d5icfa1:

Click to download the PDB-style file with coordinates for d5icfa1.
(The format of our PDB-style files is described here.)

Timeline for d5icfa1: