Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (68 species) not a true protein |
Species Thalictrum flavum [TaxId:150095] [318179] (4 PDB entries) |
Domain d5icfa1: 5icf A:3-104 [318269] Other proteins in same PDB: d5icfa2, d5icfa3 automated match to d1fp2a1 complexed with dms, edo, k, na, sah, sau |
PDB Entry: 5icf (more details), 1.8 Å
SCOPe Domain Sequences for d5icfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5icfa1 a.4.5.0 (A:3-104) automated matches {Thalictrum flavum [TaxId: 150095]} minkenlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvn qdalyrvlrylvhmklftkssidgelryglappakflvkgwd
Timeline for d5icfa1: