SCOP 1.73: Domain d1ay0b1: 1ay0 B:3-337

Lineage for d1ay0b1 (1ay0 B:3-337)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.10: TK-like PP module [88760] (2 proteins)
   different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain

6. Protein Transketolase (TK), PP module [88761] (4 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88762] (7 PDB entries)

8. Domain d1ay0b1: 1ay0 B:3-337 [31825]
   Other proteins in same PDB: d1ay0a2, d1ay0a3, d1ay0b2, d1ay0b3
   complexed with ca, tpp; mutant

Details for d1ay0b1

PDB Entry: 1ay0, 2.6 Å

PDB Description: identification of catalytically important residues in yeast transketolase

PDB Compounds: (B:) transketolase

SCOP Domain Sequences for d1ay0b1:

Sequence; same for both SEQRES and ATOM records:

>d1ay0b1 c.36.1.10 (B:3-337) Transketolase (TK), PP module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
likmtttigygslhagshsvagaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
kpgveannkwnklfseyqkkfpelgaelarrlsgq

Timeline for d1ay0b1:

• d1ay0b1 first appeared (with stable ids) in SCOP 1.55
  
• d1ay0b1 appears in SCOP 1.71
  
• d1ay0b1 appears in SCOP 1.75
  
• d1ay0b1 appears in the current release, SCOPe 2.08