Lineage for d5i1gl1 (5i1g L:1-106)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2344610Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2347168Protein automated matches [190119] (21 species)
    not a true protein
  7. 2347244Species Human (Homo sapiens) [TaxId:9606] [188740] (228 PDB entries)
  8. 2347473Domain d5i1gl1: 5i1g L:1-106 [318239]
    Other proteins in same PDB: d5i1gl2
    automated match to d1dn0a1
    complexed with so4

Details for d5i1gl1

PDB Entry: 5i1g (more details), 2.3 Å

PDB Description: crystal structure of human germline antibody ighv3-53/igkv3-11
PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d5i1gl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i1gl1 b.1.1.1 (L:1-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eivltqspatlslspgeratlscrasqsvssylawyqqkpgqaprlliydasnratgipa
rfsgsgsgtdftltisslepedfavyycqqrsnwpltfgqgtkvei

SCOPe Domain Coordinates for d5i1gl1:

Click to download the PDB-style file with coordinates for d5i1gl1.
(The format of our PDB-style files is described here.)

Timeline for d5i1gl1: