Lineage for d5icga2 (5icg A:105-350)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130608Family c.66.1.0: automated matches [191451] (1 protein)
    not a true family
  6. 2130609Protein automated matches [190689] (64 species)
    not a true protein
  7. 2274880Species Thalictrum flavum [TaxId:150095] [318181] (4 PDB entries)
  8. 2274881Domain d5icga2: 5icg A:105-350 [318182]
    Other proteins in same PDB: d5icga1
    automated match to d1fp2a2
    complexed with k

Details for d5icga2

PDB Entry: 5icg (more details), 2.6 Å

PDB Description: crystal structure of apo (s)-norcoclaurine 6-o-methyltransferase
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icga2:

Sequence, based on SEQRES records: (download)

>d5icga2 c.66.1.0 (A:105-350) automated matches {Thalictrum flavum [TaxId: 150095]}
kcmlgailtitdkdfmapwhylkegilndgststafekalgtniwdymaehpeknqlfne
gmandtrlimsalvkecssmfdgittivdvgggtgtavrniakafphikctvydlphvia
dspgyteinsiqgdmfkyipnadaimmkcilhdwddkecieilkrckdavprdggkviii
diildvksehpytkmrltldldmmlntggkerteeewkklihdagykgykithisavqsv
ieaypy

Sequence, based on observed residues (ATOM records): (download)

>d5icga2 c.66.1.0 (A:105-350) automated matches {Thalictrum flavum [TaxId: 150095]}
kcmlgailtitdkdfmapwhylkegilndststafekalgtniwdymaehpeknqlfneg
mandtrlimsalvkecssmfdgittivdvgggtgtavrniakafphikctvydlphviip
nadaimmkcilhdwddkecieilkrckdavprdggkviiidiildvksehpytkmrltld
ldmmlntggkerteeewkklihdagykgykithisavqsvieaypy

SCOPe Domain Coordinates for d5icga2:

Click to download the PDB-style file with coordinates for d5icga2.
(The format of our PDB-style files is described here.)

Timeline for d5icga2:

  • d5icga2 appears in periodic updates to SCOPe 2.06 starting on 2016-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5icga1