Lineage for d5icga1 (5icg A:8-104)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1981147Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1982196Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1983660Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1983661Protein automated matches [190154] (68 species)
    not a true protein
  7. 2274878Species Thalictrum flavum [TaxId:150095] [318179] (4 PDB entries)
  8. 2274879Domain d5icga1: 5icg A:8-104 [318180]
    Other proteins in same PDB: d5icga2
    automated match to d1fp2a1
    complexed with k

Details for d5icga1

PDB Entry: 5icg (more details), 2.6 Å

PDB Description: crystal structure of apo (s)-norcoclaurine 6-o-methyltransferase
PDB Compounds: (A:) (S)-norcoclaurine 6-O-methyltransferase

SCOPe Domain Sequences for d5icga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5icga1 a.4.5.0 (A:8-104) automated matches {Thalictrum flavum [TaxId: 150095]}
nlssqaklwnfiygfadslvlksavqldlaniihnhgspmtlselslhlpsqpvnqdaly
rvlrylvhmklftkssidgelryglappakflvkgwd

SCOPe Domain Coordinates for d5icga1:

Click to download the PDB-style file with coordinates for d5icga1.
(The format of our PDB-style files is described here.)

Timeline for d5icga1:

  • d5icga1 appears in periodic updates to SCOPe 2.06 starting on 2016-06-08

View in 3D
Domains from same chain:
(mouse over for more information)
d5icga2