Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families) |
Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins) |
Protein automated matches [190540] (4 species) not a true protein |
Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries) |
Domain d5aysb1: 5ays B:17-244 [318165] Other proteins in same PDB: d5aysa2, d5aysb2 automated match to d4l5na_ protein/DNA complex |
PDB Entry: 5ays (more details), 2.09 Å
SCOPe Domain Sequences for d5aysb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5aysb1 c.18.1.1 (B:17-244) automated matches {Herpes simplex virus type 1 [TaxId: 10299]} ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv
Timeline for d5aysb1: