SCOPe 2.06: Domain d5aysa1: 5ays A:17-244

Lineage for d5aysa1 (5ays A:17-244)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.1: Uracil-DNA glycosylase [52142] (2 proteins)

6. Protein automated matches [190540] (4 species)
   not a true protein

7. Species Herpes simplex virus type 1 [TaxId:10299] [226744] (2 PDB entries)

8. Domain d5aysa1: 5ays A:17-244 [318140]
   Other proteins in same PDB: d5aysa2, d5aysb2
   automated match to d4l5na_
   protein/DNA complex

Details for d5aysa1

PDB Entry: 5ays, 2.09 Å

PDB Description: crystal structure of saugi/hsv udg complex

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d5aysa1:

Sequence; same for both SEQRES and ATOM records:

>d5aysa1 c.18.1.1 (A:17-244) automated matches {Herpes simplex virus type 1 [TaxId: 10299]}
ldwttfrrvfliddawrplmepelanpltahllaeynrrcqteevlppredvfswtryct
pdevrvviigqdpyhhpgqahglafsvranvppppslrnvlaavkncypearmsghgcle
kwardgvlllnttltvkrgaaashsrigwdrfvggvirrlaarrpglvfmlwgthaqnai
rpdprvhcvlkfshpsplskvpfgtcqhflvanryletrsispidwsv

Timeline for d5aysa1:

• d5aysa1 is new in SCOPe 2.06-stable
  
• d5aysa1 appears in SCOPe 2.07
  
• d5aysa1 appears in the current release, SCOPe 2.08