Lineage for d5btqa_ (5btq A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2732616Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2732617Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2732618Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 proteins)
    automatically mapped to Pfam PF01126
  6. 2732664Protein Heme oxygenase-1 (HO-1) [48615] (3 species)
  7. 2732665Species Human (Homo sapiens) [TaxId:9606] [48616] (26 PDB entries)
    Uniprot P09601
  8. 2732712Domain d5btqa_: 5btq A: [318130]
    automated match to d1ni6c_
    complexed with bla, so4

Details for d5btqa_

PDB Entry: 5btq (more details), 2.08 Å

PDB Description: crystal structure of human heme oxygenase 1 h25r with biliverdin bound
PDB Compounds: (A:) Heme oxygenase 1

SCOPe Domain Sequences for d5btqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5btqa_ a.132.1.1 (A:) Heme oxygenase-1 (HO-1) {Human (Homo sapiens) [TaxId: 9606]}
qdlsealkeatkevrtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernke
spvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellv
ahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsle
mtpavrqrvieeaktafllniqlfeelqellth

SCOPe Domain Coordinates for d5btqa_:

Click to download the PDB-style file with coordinates for d5btqa_.
(The format of our PDB-style files is described here.)

Timeline for d5btqa_: