Lineage for d5csrb_ (5csr B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2826026Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2826483Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2826484Protein automated matches [190605] (25 species)
    not a true protein
  7. 2826621Species Thermoplasma acidophilum [TaxId:273075] [318086] (2 PDB entries)
  8. 2826623Domain d5csrb_: 5csr B: [318128]
    Other proteins in same PDB: d5csrc2, d5csrd2
    automated match to d2h6ra_
    complexed with cl, gol

Details for d5csrb_

PDB Entry: 5csr (more details), 1.94 Å

PDB Description: crystal structure of triosephosphate isomerase from thermoplasma acidophilium
PDB Compounds: (B:) triosephosphate isomerase

SCOPe Domain Sequences for d5csrb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5csrb_ c.1.1.0 (B:) automated matches {Thermoplasma acidophilum [TaxId: 273075]}
mytaivnlktyreatganftrfmekfepvqgkfelifspslldlekaakcgkfrffaqhv
daepygaytghvpmdmmidlgitgsilnhserrlprdtiintlkkaskldftivlcvena
eeakyfreyepdfiayeprdliggdvsvstakpeiiedivkiyegtgtsvlvgagiktge
dvrrsiglgargilvasgvvksadptkslnsliel

SCOPe Domain Coordinates for d5csrb_:

Click to download the PDB-style file with coordinates for d5csrb_.
(The format of our PDB-style files is described here.)

Timeline for d5csrb_: