Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.224: SufE/NifU [82648] (1 superfamily) alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123 |
Superfamily d.224.1: SufE/NifU [82649] (4 families) iron-sulfur cluster assembly proteins |
Family d.224.1.1: SufE-like [82650] (3 proteins) Fe-S metabolism associated domain automatically mapped to Pfam PF02657 |
Protein automated matches [191012] (4 species) not a true protein |
Species Escherichia coli [TaxId:562] [318108] (1 PDB entry) |
Domain d5eepa_: 5eep A: [318109] automated match to d4lw4c_ |
PDB Entry: 5eep (more details), 2.4 Å
SCOPe Domain Sequences for d5eepa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5eepa_ d.224.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]} ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa srsqglnalseaiiaaakqv
Timeline for d5eepa_: