Lineage for d5eepa_ (5eep A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3007687Fold d.224: SufE/NifU [82648] (1 superfamily)
    alpha(2)-beta(3)-alpha(3); 2 layers alpha/beta, 3-stranded antiparallel beta-sheet; order 123
  4. 3007688Superfamily d.224.1: SufE/NifU [82649] (4 families) (S)
    iron-sulfur cluster assembly proteins
  5. 3007689Family d.224.1.1: SufE-like [82650] (3 proteins)
    Fe-S metabolism associated domain
    automatically mapped to Pfam PF02657
  6. 3007697Protein automated matches [191012] (4 species)
    not a true protein
  7. 3007698Species Escherichia coli [TaxId:562] [318108] (1 PDB entry)
  8. 3007699Domain d5eepa_: 5eep A: [318109]
    automated match to d4lw4c_

Details for d5eepa_

PDB Entry: 5eep (more details), 2.4 Å

PDB Description: crystal structure of e. coli csde
PDB Compounds: (A:) CsdA-binding activator

SCOPe Domain Sequences for d5eepa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5eepa_ d.224.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
ghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiagcenrvwl
gytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelglraqlsa
srsqglnalseaiiaaakqv

SCOPe Domain Coordinates for d5eepa_:

Click to download the PDB-style file with coordinates for d5eepa_.
(The format of our PDB-style files is described here.)

Timeline for d5eepa_: