Lineage for d1tkbb2 (1tkb B:338-534)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162387Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1162388Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1162531Family c.36.1.6: TK-like Pyr module [88735] (2 proteins)
    different order of the modules, PP module is N-terminal, Pyr module is next to it followed by a Rossmann-like domain
  6. 1162550Protein Transketolase (TK), Pyr module [88736] (4 species)
  7. 1162551Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [88737] (7 PDB entries)
  8. 1162557Domain d1tkbb2: 1tkb B:338-534 [31810]
    Other proteins in same PDB: d1tkba1, d1tkba3, d1tkbb1, d1tkbb3
    complexed with ca, n1t

Details for d1tkbb2

PDB Entry: 1tkb (more details), 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate
PDB Compounds: (B:) transketolase

SCOPe Domain Sequences for d1tkbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkbb2 c.36.1.6 (B:338-534) Transketolase (TK), Pyr module {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOPe Domain Coordinates for d1tkbb2:

Click to download the PDB-style file with coordinates for d1tkbb2.
(The format of our PDB-style files is described here.)

Timeline for d1tkbb2: