SCOP 1.57: Domain d1tkbb2: 1tkb B:338-534

Lineage for d1tkbb2 (1tkb B:338-534)

1. Root: SCOP 1.57

2. Class c: Alpha and beta proteins (a/b) [51349] (107 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families)

5. Family c.36.1.2: Transketolase, TK [52528] (1 protein)

6. Protein Transketolase, TK [52529] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries)

8. Domain d1tkbb2: 1tkb B:338-534 [31810]
   Other proteins in same PDB: d1tkba3, d1tkbb3

Details for d1tkbb2

PDB Entry: 1tkb, 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkbb2:

Sequence; same for both SEQRES and ATOM records:

>d1tkbb2 c.36.1.2 (B:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

Timeline for d1tkbb2:

• d1tkbb2 first appeared (with stable ids) in SCOP 1.55
  
• d1tkbb2 appears in SCOP 1.59
  
• d1tkbb2 appears in the current release, SCOPe 2.08