Lineage for d1tkba2 (1tkb A:338-534)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69401Family c.36.1.2: Transketolase, TK [52528] (1 protein)
  6. 69402Protein Transketolase, TK [52529] (1 species)
  7. 69403Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries)
  8. 69409Domain d1tkba2: 1tkb A:338-534 [31808]
    Other proteins in same PDB: d1tkba3, d1tkbb3

Details for d1tkba2

PDB Entry: 1tkb (more details), 2.3 Å

PDB Description: specificity of coenzyme binding in thiamin diphosphate dependent enzymes: crystal structures of yeast transketolase in complex with analogs of thiamin diphosphate

SCOP Domain Sequences for d1tkba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tkba2 c.36.1.2 (A:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)}
lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf
qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa
lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles
khtpsiialsrqnlpql

SCOP Domain Coordinates for d1tkba2:

Click to download the PDB-style file with coordinates for d1tkba2.
(The format of our PDB-style files is described here.)

Timeline for d1tkba2: