Class c: Alpha and beta proteins (a/b) [51349] (97 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) |
Family c.36.1.2: Transketolase, TK [52528] (1 protein) |
Protein Transketolase, TK [52529] (1 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52530] (6 PDB entries) |
Domain d1tkba2: 1tkb A:338-534 [31808] Other proteins in same PDB: d1tkba3, d1tkbb3 |
PDB Entry: 1tkb (more details), 2.3 Å
SCOP Domain Sequences for d1tkba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1tkba2 c.36.1.2 (A:338-534) Transketolase, TK {Baker's yeast (Saccharomyces cerevisiae)} lpanwesklptytakdsavatrklsetvledvynqlpeliggsadltpsnltrwkealdf qppssgsgnysgryirygirehamgaimngisafganykpyggtflnfvsyaagavrlsa lsghpviwvathdsigvgedgpthqpietlahfrslpniqvwrpadgnevsaayknsles khtpsiialsrqnlpql
Timeline for d1tkba2: