SCOPe 2.08: Domain d5hysf2: 5hys F:111-215

Lineage for d5hysf2 (5hys F:111-215)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5hysf2: 5hys F:111-215 [318043]
   Other proteins in same PDB: d5hysa_, d5hysb1, d5hysc_, d5hysd1, d5hyse_, d5hysf1, d5hysh_, d5hysl1
   automated match to d1dn0a2
   complexed with so4

Details for d5hysf2

PDB Entry: 5hys, 2.5 Å

PDB Description: structure of ige complexed with omalizumab

PDB Compounds: (F:) Uncharacterized protein

SCOPe Domain Sequences for d5hysf2:

Sequence; same for both SEQRES and ATOM records:

>d5hysf2 b.1.1.2 (F:111-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnr

Timeline for d5hysf2:

• d5hysf2 first appeared in SCOPe 2.06
  
• d5hysf2 appears in SCOPe 2.07