SCOPe 2.08: Domain d5hdob_: 5hdo B:

Lineage for d5hdob_ (5hdo B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries)

8. Domain d5hdob_: 5hdo B: [318014]
   Other proteins in same PDB: d5hdoc2
   automated match to d2vyrh_
   complexed with cl, so4

Details for d5hdob_

PDB Entry: 5hdo, 2.16 Å

PDB Description: crystal structure of a nanobody raised against urokinase-type plasminogen activator

PDB Compounds: (B:) Anti-HCV NS3/4A serine protease immoglobulin heavy chain

SCOPe Domain Sequences for d5hdob_:

Sequence; same for both SEQRES and ATOM records:

>d5hdob_ b.1.1.1 (B:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]}
qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny
adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg
tqvtvss

Timeline for d5hdob_:

• d5hdob_ first appeared in SCOPe 2.06
  
• d5hdob_ appears in SCOPe 2.07