Lineage for d1bfd_2 (1bfd 2-181)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69360Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
  4. 69361Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) (S)
  5. 69362Family c.36.1.1: Pyruvate oxidase and decarboxylase [52519] (3 proteins)
  6. 69363Protein Benzoylformate decarboxylase [52526] (1 species)
  7. 69364Species Pseudomonas putida [TaxId:303] [52527] (1 PDB entry)
  8. 69365Domain d1bfd_2: 1bfd 2-181 [31801]
    Other proteins in same PDB: d1bfd_1

Details for d1bfd_2

PDB Entry: 1bfd (more details), 1.6 Å

PDB Description: benzoylformate decarboxylase from pseudomonas putida

SCOP Domain Sequences for d1bfd_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bfd_2 c.36.1.1 (2-181) Benzoylformate decarboxylase {Pseudomonas putida}
asvhgttyellrrqgidtvfgnpgsnelpflkdfpedfryilalqeacvvgiadgyaqas
rkpafinlhsaagtgnamgalsnawnshsplivtagqqtramigvealltnvdaanlprp
lvkwsyepasaaevphamsraihmasmapqgpvylsvpyddwdkdadpqshhlfdrhvss

SCOP Domain Coordinates for d1bfd_2:

Click to download the PDB-style file with coordinates for d1bfd_2.
(The format of our PDB-style files is described here.)

Timeline for d1bfd_2: