Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (24 species) not a true protein |
Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (42 PDB entries) |
Domain d5hdoc1: 5hdo C:1-127 [317976] Other proteins in same PDB: d5hdoc2 automated match to d2vyrh_ complexed with cl, so4 |
PDB Entry: 5hdo (more details), 2.16 Å
SCOPe Domain Sequences for d5hdoc1:
Sequence, based on SEQRES records: (download)
>d5hdoc1 b.1.1.1 (C:1-127) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg tqvtvss
>d5hdoc1 b.1.1.1 (C:1-127) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsrrrylevwgqgtqv tvss
Timeline for d5hdoc1: