Lineage for d5hgga_ (5hgg A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2794859Family b.47.1.2: Eukaryotic proteases [50514] (49 proteins)
  6. 2796708Protein Urokinase-type plasminogen activator (LMW U-PA), catalytic domain [50586] (1 species)
  7. 2796709Species Human (Homo sapiens) [TaxId:9606] [50587] (101 PDB entries)
    Uniprot P00749 156-178,179-424
  8. 2796775Domain d5hgga_: 5hgg A: [317960]
    Other proteins in same PDB: d5hggs_, d5hggt1, d5hggt2
    automated match to d4h42u_
    complexed with gol, mes, so4, twn

Details for d5hgga_

PDB Entry: 5hgg (more details), 1.97 Å

PDB Description: crystal structure of upa in complex with a camelid-derived antibody fragment
PDB Compounds: (A:) urokinase-type plasminogen activator

SCOPe Domain Sequences for d5hgga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hgga_ b.47.1.2 (A:) Urokinase-type plasminogen activator (LMW U-PA), catalytic domain {Human (Homo sapiens) [TaxId: 9606]}
iiggefttienqpwfaaiyrrhrggsvtyvcggslispcwvisathcfidypkkedyivy
lgrsrlnsntqgemkfevenlilhkdysadtlahhndiallkirskegrcaqpsrtiqti
alpsmyndpqfgtsceitgfgkeqstdylypeqlkmtvvklishrecqqphyygsevttk
mlcaadpqwktdscqgdsggplvcslqgrmtltgivswgrgcalkdkpgvytrvshflpw
irshtk

SCOPe Domain Coordinates for d5hgga_:

Click to download the PDB-style file with coordinates for d5hgga_.
(The format of our PDB-style files is described here.)

Timeline for d5hgga_: