![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (21 species) not a true protein |
![]() | Species Camel (Camelus dromedarius) [TaxId:9838] [187219] (37 PDB entries) |
![]() | Domain d5hdod_: 5hdo D: [317959] Other proteins in same PDB: d5hdoc2 automated match to d2vyrh_ complexed with cl, so4 |
PDB Entry: 5hdo (more details), 2.16 Å
SCOPe Domain Sequences for d5hdod_:
Sequence, based on SEQRES records: (download)
>d5hdod_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsesgrrrylevwgqg tqvtvss
>d5hdod_ b.1.1.1 (D:) automated matches {Camel (Camelus dromedarius) [TaxId: 9838]} qvqlqesggglvqaggslrlscaasgftldsyaigwfrqapgkeregvscisasggstny adsvkgrftisrdnakntvylqmnslksedtavyycaadhpglctsrrrylevwgqgtqv tvss
Timeline for d5hdod_:
![]() Domains from other chains: (mouse over for more information) d5hdoa_, d5hdob_, d5hdoc1, d5hdoc2 |