Lineage for d5dmje_ (5dmj E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 2743510Domain d5dmje_: 5dmj E: [317955]
    automated match to d4y5vd_
    complexed with k

Details for d5dmje_

PDB Entry: 5dmj (more details), 2.79 Å

PDB Description: structure of the extracellular domain of the cd40 in complex with 3h56-5 dab
PDB Compounds: (E:) 3H65-5 domain antibody (dAb)

SCOPe Domain Sequences for d5dmje_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dmje_ b.1.1.1 (E:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tevqllesggglvqpggslrlscaasgftfrdyemwwvrqapgkglervsainpqgtrty
yadsvmgrftisrdnskntlylqmnslraedtavyycaklpftfddwgqgtlvtvs

SCOPe Domain Coordinates for d5dmje_:

Click to download the PDB-style file with coordinates for d5dmje_.
(The format of our PDB-style files is described here.)

Timeline for d5dmje_: