Lineage for d1poxa2 (1pox A:9-182)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1844143Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 1844144Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 1844145Family c.36.1.5: Pyruvate oxidase and decarboxylase Pyr module [88724] (8 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpha/beta domain of Rossmann-like topology
    automatically mapped to Pfam PF02776
  6. 1844265Protein Pyruvate oxidase [88729] (2 species)
  7. Species Lactobacillus plantarum [TaxId:1590] [88730] (2 PDB entries)
  8. 1844270Domain d1poxa2: 1pox A:9-182 [31793]
    Other proteins in same PDB: d1poxa1, d1poxa3, d1poxb1, d1poxb3
    complexed with fad, gol, mg, na, tpp; mutant

Details for d1poxa2

PDB Entry: 1pox (more details), 2.1 Å

PDB Description: the refined structures of a stabilized mutant and of wild-type pyruvate oxidase from lactobacillus plantarum
PDB Compounds: (A:) Pyruvate oxidase

SCOPe Domain Sequences for d1poxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1poxa2 c.36.1.5 (A:9-182) Pyruvate oxidase {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqisaedw

SCOPe Domain Coordinates for d1poxa2:

Click to download the PDB-style file with coordinates for d1poxa2.
(The format of our PDB-style files is described here.)

Timeline for d1poxa2: