SCOPe 2.08: Domain d5c1xb1: 5c1x B:1-180

Lineage for d5c1xb1 (5c1x B:1-180)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Enterovirus a71 [TaxId:39054] [279546] (12 PDB entries)

8. Domain d5c1xb1: 5c1x B:1-180 [317928]
   Other proteins in same PDB: d5c1xa2, d5c1xb2
   automated match to d2vb0a_
   complexed with ghx

Details for d5c1xb1

PDB Entry: 5c1x, 1.86 Å

PDB Description: crystal structure of ev71 3c proteinase in complex with compound viii

PDB Compounds: (B:) 3C proteinase

SCOPe Domain Sequences for d5c1xb1:

Sequence; same for both SEQRES and ATOM records:

>d5c1xb1 b.47.1.4 (B:1-180) automated matches {Enterovirus a71 [TaxId: 39054]}
gpsldfalsllrrnvrqvqtdqghftmlgvrdrlavlprhsqpgktiwiehklvnildav
elvdeqgvnleltlitldtnekfrditkfipenistasdatlvintehmpsmfvpvgdvv
qygflnlsgkpthrtmmynfptkagqcggvvtsvgkvigihiggngrqgfcaglkrsyfa

Timeline for d5c1xb1:

• d5c1xb1 first appeared in SCOPe 2.06
  
• d5c1xb1 appears in SCOPe 2.07