Lineage for d1zpde3 (1zpd E:363-566)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 393047Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 393048Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 393191Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 393249Protein Pyruvate decarboxylase [88750] (3 species)
  7. 393258Species Zymomonas mobilis [TaxId:542] [88753] (1 PDB entry)
  8. 393261Domain d1zpde3: 1zpd E:363-566 [31790]
    Other proteins in same PDB: d1zpda1, d1zpda2, d1zpdb1, d1zpdb2, d1zpde1, d1zpde2, d1zpdf1, d1zpdf2

Details for d1zpde3

PDB Entry: 1zpd (more details), 1.86 Å

PDB Description: pyruvate decarboxylase from zymomonas mobilis

SCOP Domain Sequences for d1zpde3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zpde3 c.36.1.9 (E:363-566) Pyruvate decarboxylase {Zymomonas mobilis}
aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa
fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn
niknwdyaglmevfngnggydsgaakglkaktggelaeaikvalantdgptliecfigre
dcteelvkwgkrvaaansrkpvnk

SCOP Domain Coordinates for d1zpde3:

Click to download the PDB-style file with coordinates for d1zpde3.
(The format of our PDB-style files is described here.)

Timeline for d1zpde3: