Lineage for d5fkaa2 (5fka A:114-204)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2362648Domain d5fkaa2: 5fka A:114-204 [317876]
    Other proteins in same PDB: d5fkaa1, d5fkab1, d5fkab2, d5fkac1, d5fkac2
    automated match to d4eura2
    complexed with zn

Details for d5fkaa2

PDB Entry: 5fka (more details), 2.4 Å

PDB Description: crystal structure of staphylococcal enterotoxin e in complex with a t cell receptor
PDB Compounds: (A:) T cell receptor alpha chain

SCOPe Domain Sequences for d5fkaa2:

Sequence, based on SEQRES records: (download)

>d5fkaa2 b.1.1.2 (A:114-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpspe

Sequence, based on observed residues (ATOM records): (download)

>d5fkaa2 b.1.1.2 (A:114-204) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffpspe

SCOPe Domain Coordinates for d5fkaa2:

Click to download the PDB-style file with coordinates for d5fkaa2.
(The format of our PDB-style files is described here.)

Timeline for d5fkaa2: