Lineage for d4zy3a_ (4zy3 A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2398193Fold b.68: 6-bladed beta-propeller [50938] (11 superfamilies)
    consists of six 4-stranded beta-sheet motifs; meander
  4. 2399047Superfamily b.68.11: Kelch motif [117281] (2 families) (S)
  5. 2399091Family b.68.11.0: automated matches [191536] (1 protein)
    not a true family
  6. 2399092Protein automated matches [190912] (2 species)
    not a true protein
  7. 2399099Species Mouse (Mus musculus) [TaxId:10090] [317861] (1 PDB entry)
  8. 2399100Domain d4zy3a_: 4zy3 A: [317871]
    automated match to d2xn4a_
    complexed with fmt, k67

Details for d4zy3a_

PDB Entry: 4zy3 (more details), 1.8 Å

PDB Description: crystal structure of keap1 in complex with a small chemical compound, k67
PDB Compounds: (A:) Kelch-like ECH-associated protein 1

SCOPe Domain Sequences for d4zy3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zy3a_ b.68.11.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
grliytaggyfrqslsyleaynpsngswlrladlqvprsglagcvvggllyavggrnnsp
dgntdssaldcynpmtnqwspcasmsvprnrigvgvidghiyavggshgcihhssverye
perdewhlvapmltrrigvgvavlnrllyavggfdgtnrlnsaecyypernewrmitpmn
tirsgagvcvlhnciyaaggydgqdqlnsverydvetetwtfvapmrhhrsalgitvhqg
kiyvlggydghtfldsvecydpdsdtwsevtrmtsgrsgvgvavt

SCOPe Domain Coordinates for d4zy3a_:

Click to download the PDB-style file with coordinates for d4zy3a_.
(The format of our PDB-style files is described here.)

Timeline for d4zy3a_: