![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
![]() | Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families) ![]() there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules |
![]() | Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (8 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
![]() | Protein Pyruvate decarboxylase [88750] (3 species) |
![]() | Species Zymomonas mobilis [TaxId:542] [88753] (1 PDB entry) |
![]() | Domain d1zpda3: 1zpd A:363-566 [31786] Other proteins in same PDB: d1zpda1, d1zpda2, d1zpdb1, d1zpdb2, d1zpde1, d1zpde2, d1zpdf1, d1zpdf2 complexed with cit, dpx, mg |
PDB Entry: 1zpd (more details), 1.86 Å
SCOPe Domain Sequences for d1zpda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zpda3 c.36.1.9 (A:363-566) Pyruvate decarboxylase {Zymomonas mobilis [TaxId: 542]} aplvnaeiarqvealltpnttviaetgdswfnaqrmklpngarveyemqwghigwsvpaa fgyavgaperrnilmvgdgsfqltaqevaqmvrlklpviiflinnygytievmihdgpyn niknwdyaglmevfngnggydsgaakglkaktggelaeaikvalantdgptliecfigre dcteelvkwgkrvaaansrkpvnk
Timeline for d1zpda3: