Lineage for d2n9pc1 (2n9p C:17-101)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2177211Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2177212Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2178713Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2178714Protein automated matches [190233] (22 species)
    not a true protein
  7. 2178753Species Human (Homo sapiens) [TaxId:9606] [187090] (78 PDB entries)
  8. 2178890Domain d2n9pc1: 2n9p C:17-101 [317827]
    Other proteins in same PDB: d2n9pc2
    automated match to d5hpte_
    complexed with zn

Details for d2n9pc1

PDB Entry: 2n9p (more details)

PDB Description: solution structure of rnf126 n-terminal zinc finger domain in complex with bag6 ubiquitin-like domain
PDB Compounds: (C:) Large proline-rich protein BAG6

SCOPe Domain Sequences for d2n9pc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2n9pc1 d.15.1.0 (C:17-101) automated matches {Human (Homo sapiens) [TaxId: 9606]}
levlvktldsqtrtfivgaqmnvkefkehiaasvsipsekqrliyqgrvlqddkklqeyn
vggkvihlverappqthlpsgassg

SCOPe Domain Coordinates for d2n9pc1:

Click to download the PDB-style file with coordinates for d2n9pc1.
(The format of our PDB-style files is described here.)

Timeline for d2n9pc1: