SCOPe 2.06: Domain d5jmta2: 5jmt A:482-617

Lineage for d5jmta2 (5jmt A:482-617)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (130 species)
   not a true protein

7. Species Zika virus [TaxId:64320] [317810] (9 PDB entries)

8. Domain d5jmta2: 5jmt A:482-617 [317811]
   Other proteins in same PDB: d5jmta1
   automated match to d2bmfa1

Details for d5jmta2

PDB Entry: 5jmt, 1.8 Å

PDB Description: crystal structure of zika virus ns3 helicase

PDB Compounds: (A:) NS3 helicase

SCOPe Domain Sequences for d5jmta2:

Sequence; same for both SEQRES and ATOM records:

>d5jmta2 c.37.1.0 (A:482-617) automated matches {Zika virus [TaxId: 64320]}
edhahwlearmlldniylqdgliaslyrpeadkvaaiegefklrteqrktfvelmkrgdl
pvwlayqvasagitytdrrwcfdgttnntimedsvpaevwtrhgekrvlkprwmdarvcs
dhaalksfkefaagkr

Timeline for d5jmta2:

• d5jmta2 is new in SCOPe 2.06-stable
  
• d5jmta2 appears in SCOPe 2.07
  
• d5jmta2 appears in the current release, SCOPe 2.08