SCOPe 2.08: Domain d5j63b2: 5j63 B:204-305

Lineage for d5j63b2 (5j63 B:204-305)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.0: automated matches [227262] (1 protein)
   not a true family

6. Protein automated matches [227053] (7 species)
   not a true protein

7. Species Escherichia coli [TaxId:656414] [317792] (1 PDB entry)

8. Domain d5j63b2: 5j63 B:204-305 [317796]
   Other proteins in same PDB: d5j63a1, d5j63b1, d5j63c1, d5j63d1
   automated match to d2blna1
   complexed with fnx, g3n

Details for d5j63b2

PDB Entry: 5j63, 2.5 Å

PDB Description: crystal structure of the n-terminal n-formyltransferase domain (residues 1-306) of escherichia coli arna in complex with udp-ara4n and folinic acid

PDB Compounds: (B:) Bifunctional polymyxin resistance protein ArnA

SCOPe Domain Sequences for d5j63b2:

Sequence, based on SEQRES records:

>d5j63b2 b.46.1.0 (B:204-305) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvqgsrln

Sequence, based on observed residues (ATOM records):

>d5j63b2 b.46.1.0 (B:204-305) automated matches {Escherichia coli [TaxId: 656414]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhpaqpgsvisvaplli
acgdgaleivtgqagdgitmqgsqlaqtlglvqgsrln

Timeline for d5j63b2:

• d5j63b2 first appeared in SCOPe 2.06
  
• d5j63b2 appears in SCOPe 2.07