![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
![]() | Protein automated matches [190740] (31 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187920] (1777 PDB entries) |
![]() | Domain d5fk9b2: 5fk9 B:115-242 [317786] Other proteins in same PDB: d5fk9a2, d5fk9c1, d5fk9c2 automated match to d3q5ya2 mutant |
PDB Entry: 5fk9 (more details), 3.1 Å
SCOPe Domain Sequences for d5fk9b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5fk9b2 b.1.1.0 (B:115-242) automated matches {Human (Homo sapiens) [TaxId: 9606]} dlknvfppevavfvpseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqdprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
Timeline for d5fk9b2:
![]() Domains from other chains: (mouse over for more information) d5fk9a1, d5fk9a2, d5fk9c1, d5fk9c2 |