Class c: Alpha and beta proteins (a/b) [51349] (117 folds) |
Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465 |
Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (4 families) both pyridine (Pyr)- and pyrophosphate (PP)-binding modules have this fold conserved core consists of two Pyr and two PP-modules and binds two coenzyme molecules |
Family c.36.1.1: Pyruvate oxidase and decarboxylase THDP-binding domains [52519] (4 proteins) the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology |
Protein Pyruvate decarboxylase [52520] (3 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [52522] (2 PDB entries) |
Domain d1pvda3: 1pvd A:361-556 [31778] Other proteins in same PDB: d1pvda1, d1pvdb1 |
PDB Entry: 1pvd (more details), 2.3 Å
SCOP Domain Sequences for d1pvda3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pvda3 c.36.1.1 (A:361-556) Pyruvate decarboxylase {Baker's yeast (Saccharomyces cerevisiae)} astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml pvfdapqnlvkqaklt
Timeline for d1pvda3: