Lineage for d1pyda3 (1pyd A:361-556)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 581036Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 581037Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 581216Family c.36.1.9: Pyruvate oxidase and decarboxylase PP module [88749] (7 proteins)
    the N-terminal, Pyr module is separated from the C-terminal, PP module by an alpa/beta domain of Rossmann-like topology
  6. 581287Protein Pyruvate decarboxylase [88750] (3 species)
  7. 581293Species Brewer's yeast (Saccharomyces), uvarum strain [TaxId:230603] [88751] (1 PDB entry)
  8. 581294Domain d1pyda3: 1pyd A:361-556 [31774]
    Other proteins in same PDB: d1pyda1, d1pyda2, d1pydb1, d1pydb2

Details for d1pyda3

PDB Entry: 1pyd (more details), 2.4 Å

PDB Description: catalytic centers in the thiamin diphosphate dependent enzyme pyruvate decarboxylase at 2.4 angstroms resolution

SCOP Domain Sequences for d1pyda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyda3 c.36.1.9 (A:361-556) Pyruvate decarboxylase {Brewer's yeast (Saccharomyces), uvarum strain}
astplkqewmwnqlgnflqegdvviaetgtsafginqttfpnntygisqvlwgsigfttg
atlgaafaaeeidpkkrvilfigdgslqltvqeistmirwglkpylfvlnndgytiekli
hgpkaqyneiqgwdhlsllptfgakdyethrvattgewdkltqdksfndnskirmieiml
pvfdapqnlvkqaklt

SCOP Domain Coordinates for d1pyda3:

Click to download the PDB-style file with coordinates for d1pyda3.
(The format of our PDB-style files is described here.)

Timeline for d1pyda3: