Lineage for d5frda1 (5frd A:1-252)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152713Family c.69.1.0: automated matches [191404] (1 protein)
    not a true family
  6. 2152714Protein automated matches [190543] (91 species)
    not a true protein
  7. 2152735Species Archaeoglobus fulgidus [TaxId:2234] [317715] (1 PDB entry)
  8. 2152736Domain d5frda1: 5frd A:1-252 [317716]
    Other proteins in same PDB: d5frda2
    automated match to d3hi4a_
    complexed with cl, coa, flc, peg, pge

Details for d5frda1

PDB Entry: 5frd (more details), 1.4 Å

PDB Description: structure of a thermophilic esterase
PDB Compounds: (A:) carboxylesterase (est-2)

SCOPe Domain Sequences for d5frda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5frda1 c.69.1.0 (A:1-252) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mlervfidvdgvkvsllkgrerkvfyihssgsdatqwvnqltaiggyaidlpnhgqsdtv
evnsvdeyayyaseslkktvgkavvvghslggavaqklylrnpeiclalvlvgtgarlrv
lpeileglkkepekavdlmlsmafaskgeeyekkrrefldrvdvlhldlslcdrfdlled
yrngklkigvptlvivgeedkltplkyheffhkhipnselvvipgashmvmlekhvefne
alekflkkvgva

SCOPe Domain Coordinates for d5frda1:

Click to download the PDB-style file with coordinates for d5frda1.
(The format of our PDB-style files is described here.)

Timeline for d5frda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5frda2
View in 3D
Domains from other chains:
(mouse over for more information)
d5frdb_