SCOPe 2.08: Domain d5frda1: 5frd A:1-252

Lineage for d5frda1 (5frd A:1-252)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest

4. Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families)
   many members have left-handed crossover connection between strand 8 and additional strand 9

5. Family c.69.1.0: automated matches [191404] (1 protein)
   not a true family

6. Protein automated matches [190543] (131 species)
   not a true protein

7. Species Archaeoglobus fulgidus [TaxId:2234] [317715] (1 PDB entry)

8. Domain d5frda1: 5frd A:1-252 [317716]
   Other proteins in same PDB: d5frda2
   automated match to d3hi4a_
   complexed with cl, coa, flc, peg, pge

Details for d5frda1

PDB Entry: 5frd, 1.4 Å

PDB Description: structure of a thermophilic esterase

PDB Compounds: (A:) carboxylesterase (est-2)

SCOPe Domain Sequences for d5frda1:

Sequence; same for both SEQRES and ATOM records:

>d5frda1 c.69.1.0 (A:1-252) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}
mlervfidvdgvkvsllkgrerkvfyihssgsdatqwvnqltaiggyaidlpnhgqsdtv
evnsvdeyayyaseslkktvgkavvvghslggavaqklylrnpeiclalvlvgtgarlrv
lpeileglkkepekavdlmlsmafaskgeeyekkrrefldrvdvlhldlslcdrfdlled
yrngklkigvptlvivgeedkltplkyheffhkhipnselvvipgashmvmlekhvefne
alekflkkvgva

Timeline for d5frda1:

• d5frda1 first appeared in SCOPe 2.06
  
• d5frda1 appears in SCOPe 2.07