Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest |
Superfamily c.69.1: alpha/beta-Hydrolases [53474] (43 families) many members have left-handed crossover connection between strand 8 and additional strand 9 |
Family c.69.1.0: automated matches [191404] (1 protein) not a true family |
Protein automated matches [190543] (131 species) not a true protein |
Species Archaeoglobus fulgidus [TaxId:2234] [317715] (1 PDB entry) |
Domain d5frda1: 5frd A:1-252 [317716] Other proteins in same PDB: d5frda2 automated match to d3hi4a_ complexed with cl, coa, flc, peg, pge |
PDB Entry: 5frd (more details), 1.4 Å
SCOPe Domain Sequences for d5frda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5frda1 c.69.1.0 (A:1-252) automated matches {Archaeoglobus fulgidus [TaxId: 2234]} mlervfidvdgvkvsllkgrerkvfyihssgsdatqwvnqltaiggyaidlpnhgqsdtv evnsvdeyayyaseslkktvgkavvvghslggavaqklylrnpeiclalvlvgtgarlrv lpeileglkkepekavdlmlsmafaskgeeyekkrrefldrvdvlhldlslcdrfdlled yrngklkigvptlvivgeedkltplkyheffhkhipnselvvipgashmvmlekhvefne alekflkkvgva
Timeline for d5frda1: