Lineage for d1d9te_ (1d9t E:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242708Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 242709Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
    share a common phosphate-binding site
  5. 242710Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 242711Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 242729Species Human (Homo sapiens) [TaxId:9606] [52516] (1 PDB entry)
  8. 242734Domain d1d9te_: 1d9t E: [31771]

Details for d1d9te_

PDB Entry: 1d9t (more details), 1.75 Å

PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a

SCOP Domain Sequences for d1d9te_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9te_ c.35.1.1 (E:) Glucosamine 6-phosphate deaminase/isomerase {Human (Homo sapiens)}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike

SCOP Domain Coordinates for d1d9te_:

Click to download the PDB-style file with coordinates for d1d9te_.
(The format of our PDB-style files is described here.)

Timeline for d1d9te_: