Lineage for d5ewda_ (5ewd A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2319937Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2319938Superfamily a.29.2: Bromodomain [47370] (2 families) (S)
  5. 2320170Family a.29.2.0: automated matches [191428] (1 protein)
    not a true family
  6. 2320171Protein automated matches [190615] (14 species)
    not a true protein
  7. 2320183Species Human (Homo sapiens) [TaxId:9606] [187641] (1004 PDB entries)
  8. 2320704Domain d5ewda_: 5ewd A: [317697]
    automated match to d4lc2a_
    protein/DNA complex; complexed with 5sh, no3

Details for d5ewda_

PDB Entry: 5ewd (more details), 1.58 Å

PDB Description: crystal structure of the human brpf1 bromodomain in complex with seed18
PDB Compounds: (A:) Peregrin

SCOPe Domain Sequences for d5ewda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ewda_ a.29.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
emqltpflillrktleqlqekdtgnifsepvplsevpdyldhikkpmdfftmkqnleayr
ylnfddfeedfnlivsnclkynakdtifyraavrlreqggavlrqarrqaekm

SCOPe Domain Coordinates for d5ewda_:

Click to download the PDB-style file with coordinates for d5ewda_.
(The format of our PDB-style files is described here.)

Timeline for d5ewda_: