Lineage for d1d9tc_ (1d9t C:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69341Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily)
  4. 69342Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) (S)
  5. 69343Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 69344Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 69353Species Human (Homo sapiens) [TaxId:9606] [52516] (1 PDB entry)
  8. 69356Domain d1d9tc_: 1d9t C: [31769]

Details for d1d9tc_

PDB Entry: 1d9t (more details), 1.75 Å

PDB Description: human glucosamine-6-phosphate deaminase isomerase at 1.75 a

SCOP Domain Sequences for d1d9tc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d9tc_ c.35.1.1 (C:) Glucosamine 6-phosphate deaminase/isomerase {Human (Homo sapiens)}
mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd
lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda
feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk
vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd
edatlelkvktvkyfkglmlvhnklvdplysike

SCOP Domain Coordinates for d1d9tc_:

Click to download the PDB-style file with coordinates for d1d9tc_.
(The format of our PDB-style files is described here.)

Timeline for d1d9tc_: