Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
Fold c.35: Glucosamine 6-phosphate deaminase/isomerase [52511] (1 superfamily) |
Superfamily c.35.1: Glucosamine 6-phosphate deaminase/isomerase [52512] (1 family) |
Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein) |
Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [52516] (1 PDB entry) |
Domain d1d9tc_: 1d9t C: [31769] |
PDB Entry: 1d9t (more details), 1.75 Å
SCOP Domain Sequences for d1d9tc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d9tc_ c.35.1.1 (C:) Glucosamine 6-phosphate deaminase/isomerase {Human (Homo sapiens)} mkliilehysqasewaakyirnriiqfnpgpekyftlglptgstplgcykklieyykngd lsfkyvktfnmdeyvglprdhpesyhsfmwnnffkhidihpenthildgnavdlqaecda feekikaaggielfvggigpdghiafnepgsslvsrtrvktlamdtilanarffdgeltk vptmaltvgvgtvmdarevmilitgahkafalykaieegvnhmwtvsafqqhprtvfvcd edatlelkvktvkyfkglmlvhnklvdplysike
Timeline for d1d9tc_: