Lineage for d5adwa_ (5adw A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912237Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 2912348Superfamily c.92.2: 'Helical backbone' metal receptor [53807] (5 families) (S)
    contains a long alpha helical insertion in the interdomain linker
  5. 2912675Family c.92.2.4: TM0189-like [142789] (4 proteins)
    Part of Pfam PF01497 that include some other superfamily members
  6. 2912676Protein Enterochelin uptake protein CeuE [142792] (1 species)
  7. 2912677Species Campylobacter jejuni [TaxId:197] [142793] (11 PDB entries)
    Uniprot Q0P8Q4 44-330
  8. 2912689Domain d5adwa_: 5adw A: [317687]
    automated match to d3zkwa_
    complexed with dms, ehs, fe

Details for d5adwa_

PDB Entry: 5adw (more details), 1.9 Å

PDB Description: the periplasmic binding protein ceue of campylobacter jejuni preferentially binds the iron(iii) complex of the linear dimer component of enterobactin
PDB Compounds: (A:) enterochelin uptake periplasmic binding protein

SCOPe Domain Sequences for d5adwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5adwa_ c.92.2.4 (A:) Enterochelin uptake protein CeuE {Campylobacter jejuni [TaxId: 197]}
lpismsdegdsflvkdslgenkipknpskvvildlgildtfdalklndkvvgvpaknlpk
ylqqfknkpsvggvqqvdfeainalkpdliiisgrqskfydklkeiaptlfvgldnanfl
ssfennvlsvaklyglekealekisdikneiekaksivdedkkaliiltnsnkisafgpq
srfgiihdvlginavdenikvgthgksinsefileknpdyifvvdrnvilgnkeraqgil
dnalvaktkaaqnkkiiyldpeywylasgngleslktmileiknavk

SCOPe Domain Coordinates for d5adwa_:

Click to download the PDB-style file with coordinates for d5adwa_.
(The format of our PDB-style files is described here.)

Timeline for d5adwa_: