Lineage for d5c90i_ (5c90 I:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2852293Fold c.14: ClpP/crotonase [52095] (1 superfamily)
    core: 4 turns of (beta-beta-alpha)n superhelix
  4. 2852294Superfamily c.14.1: ClpP/crotonase [52096] (5 families) (S)
  5. 2852295Family c.14.1.1: Clp protease, ClpP subunit [52097] (2 proteins)
    automatically mapped to Pfam PF00574
  6. 2852608Protein automated matches [190149] (14 species)
    not a true protein
  7. 2852912Species Staphylococcus aureus [TaxId:93061] [189958] (8 PDB entries)
  8. 2852948Domain d5c90i_: 5c90 I: [317660]
    automated match to d3qwda_
    complexed with mpd; mutant

Details for d5c90i_

PDB Entry: 5c90 (more details), 1.75 Å

PDB Description: staphylococcus aureus clpp mutant - y63a
PDB Compounds: (I:) ATP-dependent Clp protease proteolytic subunit

SCOPe Domain Sequences for d5c90i_:

Sequence, based on SEQRES records: (download)

>d5c90i_ c.14.1.1 (I:) automated matches {Staphylococcus aureus [TaxId: 93061]}
iptviettnrgeraydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiyla
inspggsvtagfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmih
qplggaqgqateieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakey
glidevmvp

Sequence, based on observed residues (ATOM records): (download)

>d5c90i_ c.14.1.1 (I:) automated matches {Staphylococcus aureus [TaxId: 93061]}
iptvydiysrllkdriimlgsqiddnvansivsqllflqaqdsekdiylainspggsvta
gfaiydtiqhikpdvqticigmaasmgsfllaagakgkrfalpnaevmihqplggaqgqa
teieiaanhilktreklnrilsertgqsiekiqkdtdrdnfltaeeakeyglidevmvp

SCOPe Domain Coordinates for d5c90i_:

Click to download the PDB-style file with coordinates for d5c90i_.
(The format of our PDB-style files is described here.)

Timeline for d5c90i_: