Lineage for d1hota_ (1hot A:)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 242708Fold c.35: Phosphosugar isomerase [52511] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 242709Superfamily c.35.1: Phosphosugar isomerase [52512] (2 families) (S)
    share a common phosphate-binding site
  5. 242710Family c.35.1.1: Glucosamine 6-phosphate deaminase/isomerase [52513] (1 protein)
  6. 242711Protein Glucosamine 6-phosphate deaminase/isomerase [52514] (2 species)
  7. 242712Species Escherichia coli [TaxId:562] [52515] (10 PDB entries)
  8. 242725Domain d1hota_: 1hot A: [31764]

Details for d1hota_

PDB Entry: 1hot (more details), 2.4 Å

PDB Description: glucosamine 6-phosphate deaminase complexed with the allosteric activator n-acetyl-glucosamine-6-phosphate

SCOP Domain Sequences for d1hota_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hota_ c.35.1.1 (A:) Glucosamine 6-phosphate deaminase/isomerase {Escherichia coli}
mrliplttaeqvgkwaarhivnrinafkptadrpfvlglptggtpmttykalvemhkagq
vsfkhvvtfnmdeyvglpkehpesyysfmhrnffdhvdipaeninllngnapdidaecrq
yeekirsygkihlfmggvgndghiafnepasslasrtriktlthdtrvansrffdndvnq
vpkyaltvgvgtlldaeevmilvlgsqkalalqaavegcvnhmwtisclqlhpkaimvcd
epstmelkvktlryfneleaenikgl

SCOP Domain Coordinates for d1hota_:

Click to download the PDB-style file with coordinates for d1hota_.
(The format of our PDB-style files is described here.)

Timeline for d1hota_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hotb_