SCOPe 2.08: Domain d5byvj2: 5byv J:279-404

Lineage for d5byvj2 (5byv J:279-404)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries)

8. Domain d5byvj2: 5byv J:279-404 [317634]
   automated match to d4wysa2

Details for d5byvj2

PDB Entry: 5byv, 2.16 Å

PDB Description: crystal structure of msm-13, a putative t1-like thiolase from mycobacterium smegmatis

PDB Compounds: (J:) Beta-ketothiolase

SCOPe Domain Sequences for d5byvj2:

Sequence; same for both SEQRES and ATOM records:

>d5byvj2 c.95.1.0 (J:279-404) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
kplvrlvswgsagvapdlmgigpvpatevalakagltladidlielneafaaqalavmre
wkfgeadhertnvrgsgislghpvgatggrmlatlarelhrrearygletmcigggqgla
avferv

Timeline for d5byvj2:

• d5byvj2 first appeared in SCOPe 2.06
  
• d5byvj2 appears in SCOPe 2.07