SCOPe 2.08: Domain d5ecxa_: 5ecx A:

Lineage for d5ecxa_ (5ecx A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families)

5. Family c.71.1.0: automated matches [191485] (1 protein)
   not a true family

6. Protein automated matches [190777] (28 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [317424] (2 PDB entries)

8. Domain d5ecxa_: 5ecx A: [317616]
   automated match to d3data_
   complexed with 5n1, glv, gol, nap

Details for d5ecxa_

PDB Entry: 5ecx, 1.95 Å

PDB Description: klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6- (pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4- diamine

PDB Compounds: (A:) Dehydrofolate reductase type I

SCOPe Domain Sequences for d5ecxa_:

Sequence; same for both SEQRES and ATOM records:

>d5ecxa_ c.71.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mklslmvaiskngvigngpdipwsakgeqllfkaitynqwllvgrktfesmgalpnrkya
vvtrssftsdnenvlifpsikdaltnlkkitdhvivsgggeiykslidqvdtlhistidi
epegdvyfpeipsnfrpvftqdfasninysyqiwqkg

Timeline for d5ecxa_:

• d5ecxa_ first appeared in SCOPe 2.06
  
• d5ecxa_ appears in SCOPe 2.07