SCOPe 2.08: Domain d4zsoa1: 4zso A:0-106

Lineage for d4zsoa1 (4zso A:0-106)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d4zsoa1: 4zso A:0-106 [317588]
   Other proteins in same PDB: d4zsob1, d4zsob2, d4zsod1, d4zsod2
   automated match to d1um5l1
   complexed with acy, so4

Details for d4zsoa1

PDB Entry: 4zso, 2.5 Å

PDB Description: crystal structure of a complex between b7-h6, a tumor cell ligand for natural cytotoxicity receptor nkp30, and an inhibitory antibody

PDB Compounds: (A:) Antibody Light Chain

SCOPe Domain Sequences for d4zsoa1:

Sequence; same for both SEQRES and ATOM records:

>d4zsoa1 b.1.1.0 (A:0-106) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqivltqspalmsaspgekvtmtcsasssvsymywyqqkprsspkpwiyltsnlasgvpa
rfcgsgsgtsysltissmeaedaatyycqqwssnpltfgagtklelk

Timeline for d4zsoa1:

• d4zsoa1 first appeared in SCOPe 2.06
  
• d4zsoa1 appears in SCOPe 2.07