Lineage for d5ecxb_ (5ecx B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2904032Family c.71.1.0: automated matches [191485] (1 protein)
    not a true family
  6. 2904033Protein automated matches [190777] (28 species)
    not a true protein
  7. 2904214Species Klebsiella pneumoniae [TaxId:573] [317424] (2 PDB entries)
  8. 2904218Domain d5ecxb_: 5ecx B: [317587]
    automated match to d3data_
    complexed with 5n1, glv, gol, nap

Details for d5ecxb_

PDB Entry: 5ecx (more details), 1.95 Å

PDB Description: klebsiella pneumoniae dfra1 complexed with nadph and 6-ethyl-5-(3-(6- (pyridin-4-yl)benzo[d][1,3]dioxol-4-yl)but-1-yn-1-yl)pyrimidine-2,4- diamine
PDB Compounds: (B:) Dehydrofolate reductase type I

SCOPe Domain Sequences for d5ecxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ecxb_ c.71.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]}
mklslmvaiskngvigngpdipwsakgeqllfkaitynqwllvgrktfesmgalpnrkya
vvtrssftsdnenvlifpsikdaltnlkkitdhvivsgggeiykslidqvdtlhistidi
epegdvyfpeipsnfrpvftqdfasninysyqiwqkg

SCOPe Domain Coordinates for d5ecxb_:

Click to download the PDB-style file with coordinates for d5ecxb_.
(The format of our PDB-style files is described here.)

Timeline for d5ecxb_: