Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) |
Family c.71.1.0: automated matches [191485] (1 protein) not a true family |
Protein automated matches [190777] (28 species) not a true protein |
Species Klebsiella pneumoniae [TaxId:573] [317424] (2 PDB entries) |
Domain d5ecxb_: 5ecx B: [317587] automated match to d3data_ complexed with 5n1, glv, gol, nap |
PDB Entry: 5ecx (more details), 1.95 Å
SCOPe Domain Sequences for d5ecxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ecxb_ c.71.1.0 (B:) automated matches {Klebsiella pneumoniae [TaxId: 573]} mklslmvaiskngvigngpdipwsakgeqllfkaitynqwllvgrktfesmgalpnrkya vvtrssftsdnenvlifpsikdaltnlkkitdhvivsgggeiykslidqvdtlhistidi epegdvyfpeipsnfrpvftqdfasninysyqiwqkg
Timeline for d5ecxb_: