SCOPe 2.06: Domain d5e5ha1: 5e5h A:2-229

Lineage for d5e5ha1 (5e5h A:2-229)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
   core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456

4. Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families)

5. Family c.124.1.0: automated matches [191609] (1 protein)
   not a true family

6. Protein automated matches [191112] (14 species)
   not a true protein

7. Species Acetobacter aceti [TaxId:435] [226493] (17 PDB entries)

8. Domain d5e5ha1: 5e5h A:2-229 [317571]
   Other proteins in same PDB: d5e5ha3
   automated match to d4eu3a1
   complexed with 0t1, ace, act, cl, fmt, imd

Details for d5e5ha1

PDB Entry: 5e5h, 2.05 Å

PDB Description: succinyl-coa:acetate coa-transferase (aarch6) bound to acetate and degradation products from the acetyl-coa analogue dethiaacetyl-coa

PDB Compounds: (A:) Succinyl-CoA:acetate CoA-transferase

SCOPe Domain Sequences for d5e5ha1:

Sequence; same for both SEQRES and ATOM records:

>d5e5ha1 c.124.1.0 (A:2-229) automated matches {Acetobacter aceti [TaxId: 435]}
terirnvalrskvcpaetaselikhgdvvgtsgftgagypkevpkalaqrmeaahdrgek
yqislitgastgpqldgelakangvyfrspfntdatmrnrinageteyfdnhlgqvagra
vqgnygkfnialveataitedggivptssvgnsqtflnlaekviievnewqnpmlegihd
iwdgnvsgvptrdivpivradqrvggpvlrvnpdkiaaivrtndrdrn

Timeline for d5e5ha1:

• d5e5ha1 is new in SCOPe 2.06-stable
  
• d5e5ha1 appears in SCOPe 2.07
  
• d5e5ha1 appears in the current release, SCOPe 2.08