Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
Protein automated matches [196909] (60 species) not a true protein |
Species Mycobacterium smegmatis [TaxId:246196] [317395] (4 PDB entries) |
Domain d5bz4j1: 5bz4 J:4-278 [317563] automated match to d4wysa1 complexed with coa |
PDB Entry: 5bz4 (more details), 2.43 Å
SCOPe Domain Sequences for d5bz4j1:
Sequence, based on SEQRES records: (download)
>d5bz4j1 c.95.1.0 (J:4-278) automated matches {Mycobacterium smegmatis [TaxId: 246196]} rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde lavrshqravaaqsegvlaeeiipvpvrtrdgeetisvdehpradttvealaklkpvllk qdpeatvtagnssgqndaasmcivttpekaaelgl
>d5bz4j1 c.95.1.0 (J:4-278) automated matches {Mycobacterium smegmatis [TaxId: 246196]} rdavicepvrtpigryggmfrsltavdlgvtalkgllertgiaadqvedvilghcypnse apaigrvvaldaglpitvpgmqvdrrcgsglqaviqaclqvrsgdhdlvvaggaesmsnv afystdmrwggartgvqihdglargrttaggkfhpvpggmletaenlrreyhisrteqde lavrshqravaaqsegvlaeeiipvpvrtisvdehpradttvealaklkpvllkqdpeat vtagnssgqndaasmcivttpekaaelgl
Timeline for d5bz4j1: